Loading...
Statistics
Advertisement

Tweet Girl Blog – A style for every story
www.tweettweetfashion.com/
A style for every story

Tweettweetfashion.com

Advertisement
Tweettweetfashion.com is hosted in United States / San Francisco . Tweettweetfashion.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Tweettweetfashion.com

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 2
  • Facebook Box
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Tweettweetfashion.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 290319299841149202459567710774761422950543
    • validFrom: 160404130300Z
    • validTo: 160703130300Z
    • validFrom_time_t: 1459774980
    • validTo_time_t: 1467550980
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 5A:E1:CD:EB:8F:A0:52:1D:0E:59:65:BC:14:CD:85:23:A1:95:8D:2E
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:blog.tweettronics.com, DNS:tls.automattic.com, DNS:tweettweetfashion.com, DNS:tweetyandjess.com, DNS:tweetybirdbracelets.us, DNS:tweetylau.com, DNS:tweikert.com, DNS:tweldongarrettblog.com, DNS:twelfontheshelf.com, DNS:twelfthlight.com, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelvec.com, DNS:twelvechapters.com, DNS:twelvecleanpages.com, DNS:twelveconf.com, DNS:twelvedaysofchristmasblog.com, DNS:twelvedollarbeers.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemissions.com, DNS:twelvemissions.net, DNS:twelvemissions.org, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:twelveseasmagazine.com, DNS:twelvetoedtraveler.com, DNS:twelvetothirteenpointone.com, DNS:twelvetracks.com, DNS:twelvetwenty-three.com, DNS:twelvevilamar.com, DNS:twelveweeksout.com, DNS:twelvewinters.com, DNS:twelveyearsold.net, DNS:twenchilada.com, DNS:twendejikoni.com, DNS:twennythree.com, DNS:twentehofklinieken.nl, DNS:twentiesandlearning.com, DNS:twentiesbum.com, DNS:twentiescollective.com, DNS:twentiesexperience.com, DNS:twentiesfinance.net, DNS:twentiesguide.com, DNS:twentiesinyourpocket.com, DNS:twenty-everything.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Tweettweetfashion.com

Number of occurences: 12
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: google-site-verification
    Content: 5vNbpUNyZ0DI34IblLDfAkP-cmdJVIT8S6W0u7QZBgo
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: Tweet Girl Blog
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: A style for every story
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Tweet Girl Blog on WordPress.com
  • Name: description
    Content: A style for every story

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns1.wordpress.com
  • ns2.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Thu, 09 Jun 2016 15:35:25 GMT Content-Type: text/html Content-Length: 178 Location: https://tweettweetfashion.com/ X-ac: 3.bur _bur X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Thu, 09 Jun 2016 15:35:26 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: tweettweetfashion.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: tweettweetfashion.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: tweettweetfashion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: tweettweetfashion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: tweettweetfashion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: tweettweetfashion.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.weettweetfashion.com, www.tqweettweetfashion.com, www.qweettweetfashion.com, www.taweettweetfashion.com, www.aweettweetfashion.com, www.t weettweetfashion.com, www. weettweetfashion.com, www.twweettweetfashion.com, www.wweettweetfashion.com, www.teweettweetfashion.com, www.eweettweetfashion.com, www.tzweettweetfashion.com, www.zweettweetfashion.com, www.txweettweetfashion.com, www.xweettweetfashion.com, www.tcweettweetfashion.com, www.cweettweetfashion.com, www.teettweetfashion.com, www.tw eettweetfashion.com, www.t eettweetfashion.com, www.twceettweetfashion.com, www.tceettweetfashion.com, www.tweettweetfashion.com, www.teettweetfashion.com, www.twdeettweetfashion.com, www.tdeettweetfashion.com, www.twfeettweetfashion.com, www.tfeettweetfashion.com, www.twgeettweetfashion.com, www.tgeettweetfashion.com, www.twbeettweetfashion.com, www.tbeettweetfashion.com, www.twettweetfashion.com, www.twexettweetfashion.com, www.twxettweetfashion.com, www.twesettweetfashion.com, www.twsettweetfashion.com, www.twewettweetfashion.com, www.twwettweetfashion.com, www.twerettweetfashion.com, www.twrettweetfashion.com, www.twefettweetfashion.com, www.twfettweetfashion.com, www.twevettweetfashion.com, www.twvettweetfashion.com, www.twecettweetfashion.com, www.twcettweetfashion.com, www.tweqettweetfashion.com, www.twqettweetfashion.com, www.tweaettweetfashion.com, www.twaettweetfashion.com, www.tweyettweetfashion.com, www.twyettweetfashion.com, www.twettweetfashion.com, www.tweexttweetfashion.com, www.twexttweetfashion.com, www.tweesttweetfashion.com, www.twesttweetfashion.com, www.tweewttweetfashion.com, www.twewttweetfashion.com, www.tweerttweetfashion.com, www.twerttweetfashion.com, www.tweefttweetfashion.com, www.twefttweetfashion.com, www.tweevttweetfashion.com, www.twevttweetfashion.com, www.tweecttweetfashion.com, www.twecttweetfashion.com, www.tweeqttweetfashion.com, www.tweqttweetfashion.com, www.tweeattweetfashion.com, www.tweattweetfashion.com, www.tweeyttweetfashion.com, www.tweyttweetfashion.com, www.tweetweetfashion.com, www.tweetqtweetfashion.com, www.tweeqtweetfashion.com, www.tweetatweetfashion.com, www.tweeatweetfashion.com, www.tweet tweetfashion.com, www.twee tweetfashion.com, www.tweetwtweetfashion.com, www.tweewtweetfashion.com, www.tweetetweetfashion.com, www.tweeetweetfashion.com, www.tweetztweetfashion.com, www.tweeztweetfashion.com, www.tweetxtweetfashion.com, www.tweextweetfashion.com, www.tweetctweetfashion.com, www.tweectweetfashion.com, www.tweetweetfashion.com, www.tweettqweetfashion.com, www.tweetqweetfashion.com, www.tweettaweetfashion.com, www.tweetaweetfashion.com, www.tweett weetfashion.com, www.tweet weetfashion.com, www.tweettwweetfashion.com, www.tweetwweetfashion.com, www.tweetteweetfashion.com, www.tweeteweetfashion.com, www.tweettzweetfashion.com, www.tweetzweetfashion.com, www.tweettxweetfashion.com, www.tweetxweetfashion.com, www.tweettcweetfashion.com, www.tweetcweetfashion.com, www.tweetteetfashion.com, www.tweettw eetfashion.com, www.tweett eetfashion.com, www.tweettwceetfashion.com, www.tweettceetfashion.com, www.tweettweetfashion.com, www.tweetteetfashion.com, www.tweettwdeetfashion.com, www.tweettdeetfashion.com, www.tweettwfeetfashion.com, www.tweettfeetfashion.com, www.tweettwgeetfashion.com, www.tweettgeetfashion.com, www.tweettwbeetfashion.com, www.tweettbeetfashion.com, www.tweettwetfashion.com, www.tweettwexetfashion.com, www.tweettwxetfashion.com, www.tweettwesetfashion.com, www.tweettwsetfashion.com, www.tweettwewetfashion.com, www.tweettwwetfashion.com, www.tweettweretfashion.com, www.tweettwretfashion.com, www.tweettwefetfashion.com, www.tweettwfetfashion.com, www.tweettwevetfashion.com, www.tweettwvetfashion.com, www.tweettwecetfashion.com, www.tweettwcetfashion.com, www.tweettweqetfashion.com, www.tweettwqetfashion.com, www.tweettweaetfashion.com, www.tweettwaetfashion.com, www.tweettweyetfashion.com, www.tweettwyetfashion.com, www.tweettwetfashion.com, www.tweettweextfashion.com, www.tweettwextfashion.com, www.tweettweestfashion.com, www.tweettwestfashion.com, www.tweettweewtfashion.com, www.tweettwewtfashion.com, www.tweettweertfashion.com, www.tweettwertfashion.com, www.tweettweeftfashion.com, www.tweettweftfashion.com, www.tweettweevtfashion.com, www.tweettwevtfashion.com, www.tweettweectfashion.com, www.tweettwectfashion.com, www.tweettweeqtfashion.com, www.tweettweqtfashion.com, www.tweettweeatfashion.com, www.tweettweatfashion.com, www.tweettweeytfashion.com, www.tweettweytfashion.com,

Other websites we recently analyzed

  1. glc
    Brea (United States) - 173.236.191.150
    Server software: Apache
    Technology: CSS, Html, Html5
  2. MileWiz - Automatic Mileage Tracker for iOS - MileWiz
    San Francisco (United States) - 104.28.8.94
    G Analytics ID: UA-41010444-10
    Server software: cloudflare-nginx
    Technology: CSS, Font Awesome, Google Font API, Html, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, Google Analytics, Wordpress
    Number of Javascript: 31
    Number of meta tags: 5
  3. Poshaak-Designer
    Germany - 217.160.0.58
    G Analytics ID: UA-41038091-22
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 3
  4. the cross and rings
    Colorado Springs (United States) - 69.73.153.201
    Server software: Apache/2.4.18 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
    Technology: CSS, Javascript, Php, StatCounter
    Number of Javascript: 1
    Number of meta tags: 3
  5. Hilatura Colón
    United States - 139.162.209.26
    G Analytics ID: UA-69389968-1
    Server software: nginx
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 35
    Number of meta tags: 3
  6. 4strategy Inkoop Ondersteuning
    Inkoop Ondersteuning en inkoop assistentie. Maatwerk voor kleine en grote ondernemingen.
    Netherlands - 5.157.84.16
    Server software: Apache
    Technology: Html, Html5
    Number of meta tags: 2
  7. Naforo - The missing code review tool for professionals
    France - 37.187.55.40
    Server software: nginx/1.4.6 (Ubuntu)
    Technology: CSS, Google Font API, Html, Html5, Javascript, New Relic
    Number of meta tags: 2
  8. Amazing Creations Preschool
    At Amazing Creations Preschool, we believe that every child's uniqueness is to be valued. We emphasize appropriate activities in a theme based curriculum that includes educational subjects and Christian values.
    Boardman (United States) - 50.112.117.90
    Server software: Apache
    Technology: CSS, Flexslider, Html5, Javascript, jQuery Colorbox, PageSpeed Module, Php, Google Analytics, Drupal
    Number of Javascript: 9
    Number of meta tags: 5
  9. Adore The Paws | Pet Sitter and Dog Walker in Surbiton and Kingston areas
    Reliable and experienced Pet Sitter and Dog Walker in the Surbiton, Kingston, Chessington, Tolworth and Long Ditton areas
    Papillion (United States) - 70.34.32.137
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery UI, Swf Object, DotNetNuke
    Number of Javascript: 18
    Number of meta tags: 5
  10. Blog ab(out) it
    Germany - 31.47.242.196
    Server software: nginx
    Technology: CSS, Html, Javascript, jQuery, Php, Drupal
    Number of Javascript: 5
    Number of meta tags: 2

Check Other Websites